accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,880,025)
Primary Antibody Matched Pairs (7,059)
Protein Interaction Antibody Pairs (1,375)
Protein Phosphorylation Antibody Pairs (72)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (969)
  • (76,152)
  • (14,166)
  • (41)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (259)
  • (2)
  • (1,310)
  • (575)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (2)
  • (4)
  • (1)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (55)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,198)
  • (83)
  • (468)
  • (2)
  • (1)
  • (11,565)
  • (1)
  • (1)
  • (51)
  • (3,050)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,246)
  • (1)
  • (76)
  • (18,947)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (42)
  • (11,458)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,196)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (92)
  • (1)
  • (1)
  • (171)
  • (204)
  • (4)
  • (127)
  • (2)
  • (1)
  • (691)
  • (13)
  • (912)
  • (1)
  • (105)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (972)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (122)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (298)
  • (1)
  • (1,815)
  • (2)
  • (1)
  • (12)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (158,080)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (191)
  • (1,154)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (4)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (165)
  • (1)
  • (6)
  • (1)
  • (8,397)
  • (1)
  • (3)
  • (5)
  • (4)
  • (137)
  • (31)
  • (111)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,471)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,282)
  • (2)
  • (1)
  • (11,815)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (40)
  • (7)
  • (57)
  • (15)
  • (1,256,818)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (421)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (554)
  • (25)
  • (19,249)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (703)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (380)
  • (8)
  • (1)
  • (39)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (241)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (13,654)
  • (165,540)
  • (30)
  • (70,538)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,948)
  • (4,450)
Show all

Conjugate

  • (3)
  • (3)
  • (31,409)
  • (9)
  • (1)
  • (29)
  • (2,898)
Show all

Host Species

  • (564)
  • (2,897)
  • (51)
  • (1)
  • (15)
  • (1,898)
  • (726)
Show all

Regulatory Status

  • (336)
  • (964)
  • (1,700,222)

Applications

  • (983)
  • (2)
  • (36)
  • (23)
  • (193)
  • (1,232)
  • (3)
Show all

Target Species

  • (79)
  • (3)
  • (2)
  • (90)
  • (40)
  • (106)
  • (492)
Show all

Classification

  • (81)
  • (105)
  • (898,520)
  • (3,641)
  • (5)
  • (761,820)
  • (30,412)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,703)
  • (2,164)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (424,264)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
4,681 – 4,695 of 1,808,261 results
4,681

Invitrogen™ IL-1 alpha Monoclonal Antibody (ALF-161), Functional Grade, eBioscience™
GREENER_CHOICE

Armenian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Armenian Hamster
Conjugate Functional Grade
Applications Functional Assay,Immunostaining,Neutralization
Form Liquid
Gene Accession No. P01582
Isotype IgG
Concentration 1 mg/mL
Antigen IL-1 alpha
Gene Symbols Il1a
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CTLA8; hematopoietin-1; IL 1 a; IL 1α; IL1; IL-1 alpha; IL17; IL1A; Il-1a; IL-1alpha; IL1-ALPHA; IL1F1; IL1α; ILN; Interleukin; interleukin 1 alpha; interleukin 1, alpha; interleukin 17; interleukin 1a; interleukin 1-alpha; interleukin 1-alpha (AA 1 - 152); Interleukin1 alpha; interleukin-1 alpha; interleukin-1 alpha precursor; Interleukin-17A; preinterleukin 1 alpha; pre-interleukin-1 alpha; pro-interleukin-1-alpha; RP23-160G19.8
Gene Il1a
Product Type Antibody
Gene ID (Entrez) 16175
Formulation PBS with no preservative; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone ALF-161
4,682

IL-17A Monoclonal Antibody (eBioMM17F3), Functional Grade, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C
Target Species Mouse
Host Species Mouse
Conjugate Functional Grade
Applications Functional Assay,Neutralization
Form Liquid
Isotype IgG1 κ
Gene Accession No. Q62386
Concentration 1 mg/mL
Antigen IL-17A
Gene Symbols IL17A
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A
Gene IL17A
Product Type Antibody
Gene ID (Entrez) 16171
Formulation PBS with no preservative; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioMM17F3
4,683

Invitrogen™ CD257 (BAFF, BLyS) Monoclonal Antibody (1D6), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9Y275
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD257 (BAFF, BLyS)
Gene Symbols TNFSF13B
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias ApoL related ligand TALL-1; b cell-activating factor; B lymphocyte stimulator; BAFF; B-cell-activating factor; B-lymphocyte stimulator; BLYS; CD257; D8Ertd387e; delta BAFF; Delta4 BAFF; dendritic cell-derived TNF-like molecule; DTL; RGD1561519; TALL1; TALL-1; THANK; TNF- and APOL-related leukocyte expressed ligand 1; TNF and ApoL-related leukocyte expressed ligand 1; TNF homolog that activates apoptosis; Tnfsf13b; TNFSF20; TNLG7A; tumor necrosis factor (ligand) superfamily member 13b; tumor necrosis factor (ligand) superfamily, member 13b; tumor necrosis factor (ligand) superfamily, member 20; tumor necrosis factor ligand 7A; tumor necrosis factor ligand superfamily member 13B; Tumor necrosis factor ligand superfamily member 13b, membrane form; Tumor necrosis factor ligand superfamily member 13b, soluble form; tumor necrosis factor superfamily member 13b; tumor necrosis factor-like protein ZTNF4; UNQ401/PRO738; ZTNF4
Gene TNFSF13B
Product Type Antibody
Gene ID (Entrez) 10673
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 1D6
4,684

IL-33R (ST2) Monoclonal Antibody (RMST2-2), PE-Cyanine7, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE-Cyanine7
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P14719
Concentration 0.2 mg/mL
Antigen IL-33R (ST2)
Gene Symbols IL1RL1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias DER4; Fit1; Fit-1; Fos-responsive gene 1 protein; growth stimulation-expressed; homolog of mouse growth stimulation-expressed; IL-1 R4; IL1RL1; IL-1RL1; IL33R; IL-33R; interleukin 1 receptor like 1; interleukin 1 receptor-like 1; interleukin 1 receptor-related protein; Interleukin1 receptor like 1; interleukin-1 receptor-like 1; Interleukin-33 receptor alpha chain; Ly84; lymphocyte antigen 84; Protein ST2; Protein T1; sIL 33R; soluble IL 33 Receptor; soluble IL 33R; St2; ST2L; St2-rs1; ST2V; Ste2; T1; T1/ST2
Gene IL1RL1
Product Type Antibody
Gene ID (Entrez) 17082
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone RMST2-2
4,685

Invitrogen™ CD371 (Clec12A) Monoclonal Antibody (HB3), PE, eBioscience™

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q5QGZ9
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD371 (Clec12A)
Gene Symbols CLEC12A
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD371; Clec12a; CLL1; CLL-1; C-type lectin domain family 12 member A; C-type lectin domain family 12, member A; C-type lectin protein CLL-1; C-type lectin-like molecule 1; C-type lectin-like molecule-1; D230024O04; DCAL2; DCAL-2; Dendritic cell-associated lectin 2; KLRL1; Micl; Myeloid inhibitory C-type lectin-like receptor
Gene CLEC12A
Product Type Antibody
Gene ID (Entrez) 160364
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone HB3
4,686

Invitrogen™ Phospho-gamma-H2AX (Ser139) Recombinant Rabbit Monoclonal Antibody (BLR053F)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage 4°C
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P16104
Isotype IgG
Concentration 100 μg/mL
Antigen Phospho-gamma-H2AX (Ser139)
Gene Symbols H2AX
Regulatory Status RUO
Purification Method purified
Gene Alias gamma H2A X; gamma H2A.X; gamma-H2A.X; gh2ax
Gene H2AX
Product Type Antibody
Gene ID (Entrez) 3014
Formulation BBS with 0.1% BSA and 0.09% sodium azide; pH 8.2
Immunogen Peptide surrounding phosphorylated serine 140 of human histone H2AX.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone BLR053F
4,687

Invitrogen™ GSPT1 Recombinant Rabbit Monoclonal Antibody (HL1346)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P15170, Q8R050
Isotype IgG
Concentration 1 mg/mL
Antigen GSPT1
Gene Symbols GSPT1
Regulatory Status RUO
Purification Method Protein A
Gene Alias 551G9.2; AI314175; AI326449; AV307676; C79774; ELF; ERF3A; ETF3A; Eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eukaryotic peptide chain release factor subunit 3a; eukaryotic polypeptide chain release factor 3; G1 to phase transition 1; G1 to S phase transition 1; G1 to S phase transition protein 1; G1 to S phase transition protein 1 homolog; G1st; G1-to-S phase transition 1; G1-to-S transition GTP binding protein; GSPT1; GST1; Gst-1; guanine nucleotide regulatory protein
Gene GSPT1
Product Type Antibody
Gene ID (Entrez) 14852, 24420, 2935
Formulation PBS with no preservative
Immunogen Recombinant protein encompassing a sequence within the center region of human GSPT1. The exact sequence is proprietary.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone HL1346
4,688

Invitrogen™ CD369 (Clec7a, Dectin-1) Monoclonal Antibody (15E2), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human,Monkey
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9BXN2
Isotype IgG2a κ
Concentration 5 μL/Test
Antigen CD369 (Clec7a, Dectin-1)
Gene Symbols Clec7a
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Beta-glucan receptor; beta-GR; BGR; CANDF4; CD369; CLEC7A; Clec7b; CLECSF12; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; C-type lectin domain family 7 member A; C-type lectin domain family 7, member A; C-type lectin superfamily member 12; DC-associated C-type lectin 1; DECTIN1; dectin-1; Dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; lectin-like receptor 1; RGD1565140; SCARE2; UNQ539/PRO1082
Gene Clec7a
Product Type Antibody
Gene ID (Entrez) 64581
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 15E2
4,689

Invitrogen™ RAGE Monoclonal Antibody (5C6C1)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. Q15109, Q62151, Q63495
Isotype IgG2b
Concentration 500 μg/mL
Antigen RAGE
Gene Symbols AGER
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Gene AGER
Product Type Antibody
Gene ID (Entrez) 11596, 177, 81722
Formulation PBS with 4mg trehalose and no preservative
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Classification Monoclonal
Primary or Secondary Primary
Clone 5C6C1
4,690

Invitrogen™ PTH1R Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q03431
Isotype IgG
Concentration Conc. Not Determined
Antigen PTH1R
Gene Symbols Pth1r
Regulatory Status RUO
Gene Alias MGC138426; MGC138452; Parathormone; Parathyrin; parathyroid hormone 1 receptor; parathyroid hormone receptor; parathyroid hormone receptor 1; parathyroid hormone/parathyroid hormone-related peptide receptor; parathyroid hormone/parathyroid hormone-related protein receptor; PFE; PPR; PTH; PTH/PTHr receptor; PTH/PTHrP receptor; PTH/PTHrP type I receptor; PTH1 receptor; PTH1R; Pthr; Pthr1; PTHrel; PTH-related peptide receptor; PTHrP-R; PTHrP-receptor; seven transmembrane helix receptor
Gene Pth1r
Product Type Antibody
Gene ID (Entrez) 5745
Formulation whole serum with 0.02% sodium azide
Immunogen Synthetic peptide corresponding to the C-terminal amino acids E(573)EASGPERPPALLQEEWETVM(593) of PTHR1.
Classification Polyclonal
Primary or Secondary Primary
4,691

Invitrogen™ TLR7 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. P58681, Q9NYK1
Isotype IgG
Concentration 1.0 mg/mL
Antigen TLR7
Gene Symbols TLR7
Regulatory Status RUO
Purification Method Protein G
Gene Alias RGD1563357; RP23-139P21.3; Tlr7; TLR7-like; toll like receptor 7; toll-like receptor 7; toll-like receptor 7-like; UNQ248/PRO285
Gene TLR7
Product Type Antibody
Gene ID (Entrez) 170743, 317468, 51284
Formulation PBS with 0.05% sodium azide
Immunogen KLH-conjugated synthetic peptide corresponding to amino acids 706-749 of human TLR7.
Classification Polyclonal
Primary or Secondary Primary
4,692

Invitrogen™ CD7 Monoclonal Antibody (eBio124-1D1 (124-1D1)), PE, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P09564
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD7
Gene Symbols CD7
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Cd7; CD7 antigen; CD7 antigen (p41); Cd7 molecule; GP40; LEU-9; p41 protein; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp40; TP41
Gene CD7
Product Type Antibody
Gene ID (Entrez) 924
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBio124-1D1 (124-1D1)
4,693

Invitrogen™ CD4 Monoclonal Antibody (RM4-4), PE, eBioscience™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Gene Accession No. P06332
Isotype IgG2b κ
Concentration 0.2 mg/mL
Antigen CD4
Gene Symbols CD4
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene CD4
Product Type Antibody
Gene ID (Entrez) 12504
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone RM4-4
4,694

IgM Monoclonal Antibody (eB121-15F9), PE, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PE
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Concentration 0.2 mg/mL
Antigen Mouse IgM
Gene Symbols Ighm
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Ighm
Product Type Antibody
Gene ID (Entrez) 16019
Classification Monoclonal
Primary or Secondary Primary
Clone eB121-15F9
4,695

Invitrogen™ S100B Recombinant Rabbit Monoclonal Antibody (SC57-02)
GREENER_CHOICE

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Goat,Human,Mouse,Rat,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Form Liquid
Gene Accession No. P04271, P04631, P50114
Isotype IgG
Concentration 1.02 mg/mL
Antigen S100B
Gene Symbols S100B
Regulatory Status RUO
Purification Method Protein A
Gene Alias AI850290; Bpb; hypothetical protein LOC525716; NEF; protein S100-B; S100; S100 calcium binding protein B; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 calcium-binding protein beta (neural); S-100 calcium-binding protein beta subunit; S100 calcium-binding protein, beta (neural); S-100 calcium-binding protein, beta chain; S100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100 protein, beta polypeptide; S100 protein, beta polypeptide, neural; S100B; S100-B; S100beta; S100P
Gene S100B
Product Type Antibody
Gene ID (Entrez) 102169524, 20203, 25742, 436825, 6285
Formulation PBS with 0.1% BSA, 40% glycerol and 0.2% ProClin 950; pH 7.4
Immunogen Synthetic peptide within C-terminal human S100 beta.
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone SC57-02